PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02309.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 643aa    MW: 70600 Da    PI: 9.2503
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02309.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1292.4e-09283341563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ l +++
  Zpz_sc02309.1.g00020.1.am.mk 283 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGLATQN 341
                                   999******************************************99998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16279343IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714281344IPR004827Basic-leucine zipper domain
PfamPF001707.1E-9283341IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.32E-10283333No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-10283340No hitNo description
CDDcd147034.23E-22284333No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
LNRVERPSER YDHTSTPQRH RHRHRHRGRI KPSIITQARV AHDRHATVPS SDMNGAANGH  60
GMVHHHLHHH AQASAPLPTA FPLPAQHHQQ QQGAGGGSKQ RPGLPPTPPG FHAAHADVCM  120
DDSAARAQAL QGGGLPPRKA HRRSRSDVPF GMEGVDAGGL KYCSDGESRG SSMRTNGADS  180
SENESEDYGG ADSQFLVWGD GAGKKREGVK RNAAGEPAAA PAAGRHTRSL SMDSLMGKLS  240
FSANGEPAGK FSLEFGGGEF TPAEMKRIMA DEKLAEMALA DPKRVKRVLA NRQSAARSKE  300
RRMRYIAELE QKVQILQTEA TTLSAQLTLL QRDSSGLATQ NNELKFRLQA MEQQAQLRDA  360
LNEALSAEVQ RLKVGDASSS SNLPQQMQLH YQSQMHELHK QQQGEQIPFY QLEQREQNGV  420
ARNHDANVRS SEPQRPACPA VLPTEQGRLR GMAIAAHRHS GVLVAMRCFG RGEMAKRERR  480
PREESHGRPH PRHVRPRPLR YAGLGTRPGP LRCIHAWDSS IDIGHDAHSY GELANGLGHV  540
PAPRRFRGRA AEREERGYKT TLCRSGNWIK ICSMPPVKTT STRSGLLGHH SVLLSAMGFE  600
DELEGEEVES VTSKGLTEDC YGDNSCSETA NEDDMLLLIP TCC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11830RHRHRHRHRGRIK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352291e-173BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
GenBankJX4699261e-173JX469926.1 Zea mays subsp. mays clone UT3184 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.11e-156PREDICTED: transcription factor RF2b-like
TrEMBLA0A0E0MA281e-153A0A0E0MA28_ORYPU; Uncharacterized protein
STRINGGRMZM2G353553_P011e-145(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-57bZIP family protein